Sign In | Join Free | My insurersguide.com
insurersguide.com
Products
Search by Category

foam for noise reduction

All foam for noise reduction wholesalers & foam for noise reduction manufacturers come from members. We doesn't provide foam for noise reduction products or service, please contact them directly and verify their companies info carefully.

Total 7872 products from foam for noise reduction Manufactures & Suppliers
Cheap 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction for sale

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

Cheap 3mm Super EVA Foam Underlayment Noise Reduction With Blue Aluminum Film for sale

Categories:EVA Foam Underlayment

Country/Region:china

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushioning and sound absorption, as well as

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

Cheap Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor for sale

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Site Member

Jiangsu

Cheap Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam for sale

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

Cheap 10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction for sale

Brand Name:EkkoFlex

Place of Origin:Made in china

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effectively absorbs and dampens sound vibrations, ...

Shenzhen Eco Polyfoam Products Co., Ltd.
Verified Supplier

Guangdong

Cheap Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm for sale

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

Cheap Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

Cheap Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

Cheap Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs for sale

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Cheap 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor for sale

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Starking Shutter Manufacturer Limited
Verified Supplier

Cheap NOISE REDUCTION HEADPHONE #ANC-J3 for sale

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Shenzhen Bowei Electronics Co.,Ltd.
Active Member

Guangdong

Cheap Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip for sale

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Active Member

Sichuan

Cheap FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design for sale

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

FUTURE TECH LIMITED
Verified Supplier

Cheap Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction for sale

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Cheap Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone for sale

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Shengpai Electronics Co,ltd
Active Member

Guangdong

Cheap Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption for sale

Brand Name:huashida

Place of Origin:Qingdao, China

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-...

Qingdao Huashida Machinery Co., Ltd.
Verified Supplier

Shandong

Cheap 750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam for sale

Place of Origin:China

Brand Name:AEROPAK

Model Number:APK-8620

750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam 750ml Expanding Tube Foam Multi Purpose Construction Use Noise Resistant Description: I-Like PU Foam Sealant is made of high quality one-component polyurethane material. It has a ...

SHENZHEN I-LIKE FINE CHEMICAL CO., LTD
Verified Supplier

Guangdong

Cheap Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof for sale

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Anhui Arts & Crafts Import & Export Company Ltd.
Verified Supplier

Anhui

Cheap Wearproof Noise Reduction CR Sealed Foam For Mop Making for sale

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment-friendly plastic foam materials 1,introduce CR rubber and plastic products are new environment-friendly ...

Kunshan Honteck Electronic Material Co., Ltd
Active Member

Jiangsu

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request