| Sign In | Join Free | My insurersguide.com |
|
All noise reduction foam wholesalers & noise reduction foam manufacturers come from members. We doesn't provide noise reduction foam products or service, please contact them directly and verify their companies info carefully.
| Total 7088 products from noise reduction foam Manufactures & Suppliers |
|
|
|
Brand Name:HaiKe Model Number:HK95020 Place of Origin:Chongqing China Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ... |
Chongqing Haike Thermal Insulation Material Co., Ltd.
Chongqing |
|
|
Brand Name:Rogers Model Number:L-32 Place of Origin:China ...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ... |
SZ PUFENG PACKING MATERIAL LIMITED
Guangdong |
|
|
Brand Name:new top star Model Number:IXPE3030-4 Place of Origin:china ...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam... |
Changzhou New Top Star New Material Technology Co.,Ltd
|
|
|
Brand Name:CYG Model Number:4012 Place of Origin:China 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ... |
Cyg Tefa Co., Ltd.
Guangdong |
|
|
Brand Name:No Brand Model Number:30IXPE 20 Place of Origin:China ...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As... |
Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu |
|
|
Place of Origin:Zhejiang China Brand Name:FuXing Model Number:OEM ODM ...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs can meet the needs of noise |
JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Place of Origin:Qingdao, China Brand Name:Xinmei ... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device. |
Qingdao Xinmeiteng Sponge Manufacture Co.
Shandong |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Categories:Aluminum Roller Shutter Door Country/Region:china Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam... |
Starking Shutter Manufacturer Limited
|
|
|
Place of Origin:China Model Number:#ANC-J3 ... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5 |
Shenzhen Bowei Electronics Co.,Ltd.
Guangdong |
|
|
Brand Name:JYD Model Number:custom made Place of Origin:China ... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through... |
Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan |
|
|
Brand Name:Future Tech Model Number:FT-EM5002 Place of Origin:Shenzhen China ...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam... |
FUTURE TECH LIMITED
|
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job ... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
|
|
Brand Name:TC Model Number:TCNB Place of Origin:China ... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ... |
Qingdao TaiCheng transportation facilities Co.,Ltd.
Shandong |
|
|
Brand Name:Aonike Model Number:BT800 Place of Origin:China ... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ... |
Shengpai Electronics Co,ltd
Guangdong |
|
|
Brand Name:huashida Place of Origin:Qingdao, China Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-... |
Qingdao Huashida Machinery Co., Ltd.
Shandong |
|
|
Brand Name:Artshow Model Number:B09 Place of Origin:China ... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise. |
Anhui Arts & Crafts Import & Export Company Ltd.
Anhui |