Sign In | Join Free | My insurersguide.com
insurersguide.com
Products
Search by Category
Home > Machinery > Environmental Machinery > Noise Reduction Device >

Shipyard 33db Noise Reduction Ear Plugs

shipyard 33db noise reduction ear plugs

All shipyard 33db noise reduction ear plugs wholesalers & shipyard 33db noise reduction ear plugs manufacturers come from members. We doesn't provide shipyard 33db noise reduction ear plugs products or service, please contact them directly and verify their companies info carefully.

Total 13 products from shipyard 33db noise reduction ear plugs Manufactures & Suppliers
Cheap Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS for sale

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

Cheap PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility for sale

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

Description The Noise Ear Plugs realize the function to reduce work, home, sleep and safety noise. Due to the washable and reusable design, it is really friendly to the environment. As a matter of fact, it can be an ideal facility used for airplanes, ...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Cheap FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design for sale

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. 3. Good inner space for ear...

FUTURE TECH LIMITED
Verified Supplier

Cheap Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff for sale

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Sweet Home International(H.K.)Limited
Active Member

Zhejiang

Cheap Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone for sale

Brand Name:EARLISTEN

Model Number:promo

Place of Origin:CHINA

Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise...

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

Cheap Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone for sale

Brand Name:EARLISTEN

Model Number:promo

Place of Origin:CHINA

Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise...

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

Cheap Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs for sale

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Cheap Experience the Perfect Blend of Comfort and Sound with Active Noise Reduction Earbuds In-Ear Headphones for sale

Categories:3.5mm Single PIN earphone

Country/Region:china

Product Description Material PVC+ABS Length Customized Color Multi Plug 3.5mmz,Single PIN Speaker 13mm Sensitivity 104±10%DB Frequency range 20-20,000 Hz Impedance 32±2Ω Company Profile Our Factory YICHUN YUANZHOU DISTRICT HESHI ELECTRONICS CO.,LTD Yichun ...

Yichun Yuanzhou District Heshi Electronics Co., Ltd.
Verified Supplier

Cheap Multi Color Wired In Ear Earphones Flat Cable 1.2 MM Noise Cancelling Earbuds Factory for sale

Brand Name:HYQ

Model Number:3404-FY148

Place of Origin:CHINA

...Ear Earphones Wired Earphone Information Item Number 3404-FY148 Communication Wired Earphone Color Multi color Plug 3.5mm straight plug Cable Flat cable Flat Cable Specification Impedance 24Ω±5Ω Speaker size 10MM Cable length 120CM Frequency range 20Hz-20KHz Sensitivity 100dB±5dB Max power input 10mW Feature High quality sound insulation Passive noise reduction...

Guangzhou Huayi Electronic Factory
Active Member

Guangdong

Cheap 50mm Onikuma K8 Noise Cancelling Gaming Headphones for sale

Brand Name:onikuma

Model Number:k8

Place of Origin:China

...Ear Headphones with Volume Control LED Light Cool Style Stereo Noise Reduction Earphone features: Compatibility: With 3. 5mm audio cable jack (USB jack just work for LED light), wired stereo sound over ear gaming headset supports PC, Xbox One Controller(has 3. 5mm plug...

Shenzhen Ouni Technology Co.,Ltd
Verified Supplier

Cheap Titanium Film Horn Noise Cancelling Microphone Earbuds for sale

Brand Name:picun

Model Number:ANC-02

Place of Origin:Made in China

... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,

Golden Promise Industrial Mfg.Co.,Ltd.
Active Member

Cheap Foldable  Bluetooth v3.0+EDR Stereo Headset  Can use as Wired Headphone KBT-8252 for sale

Place of Origin:china

Brand Name:OEM

Model Number:KBT-8252

...3.5 plug audio cable to connect the headset to enjoy high quality music playback, good noise reduction function, functional. Bluetooth headset with pure piano paint appearance design, filling the atmosphere; full-size protein skin comfort ear, comfortable...

ShenZhen Hua Xing Watches Co.,Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request