Sign In | Join Free | My insurersguide.com
insurersguide.com
Products
Search by Category
Home > Rubber & Plastics > Plastic Products > Plastic Sheets >

Noise Reduction Cr Sealed Foam

noise reduction cr sealed foam

All noise reduction cr sealed foam wholesalers & noise reduction cr sealed foam manufacturers come from members. We doesn't provide noise reduction cr sealed foam products or service, please contact them directly and verify their companies info carefully.

Total 163 products from noise reduction cr sealed foam Manufactures & Suppliers
Cheap Wearproof Noise Reduction CR Sealed Foam For Mop Making for sale

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

... CR rubber and plastic products are new environment-friendly plastic foam materials. Good physical and mechanical properties,oil resistance,heat resistance,fire resistance,daylight resistance,ozone resistance,...

Kunshan Honteck Electronic Material Co., Ltd
Active Member

Jiangsu

Cheap Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam for sale

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product Parameters Model L -

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

Cheap Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip for sale

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Site Member

Sichuan

Cheap Cutting Foam For EV Battery Closed Cell Expanded EPDM CR EVA Foam Sponge Rubber Sheet Rolls Strips for sale

Brand Name:FQ

Model Number:FQ01

Place of Origin:China

... foam, offering excellent buffering, protection and sealing for your EV battery pack. It has excellent shock absorption, high flexibility, great heat and chemical resistance, and excellent durability. Our EV battery sealing EPDM rubber foam is designed to

Fuzhou Fuqiang Precision Co., Ltd.
Verified Supplier

Cheap 33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment for sale

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

Cheap 3mm Thick Eva Foam Underlayment 200sqft/Roll Vinyl Tile Noise Reduction Underlay for sale

Brand Name:No brand

Model Number:EVA 30-G

Place of Origin:China

... overcome the minor subfloor imperfections and insulate the noise EVA underlay has a variety of applications. They can be used under Engineered wood floor, Luxury Vinyl tile, SPC tile and plank floorings and even ...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Site Member

Jiangsu

Cheap 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction for sale

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

Cheap FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design for sale

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

FUTURE TECH LIMITED
Verified Supplier

Cheap Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction for sale

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Cheap Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm for sale

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

Cheap Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof for sale

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Anhui Arts & Crafts Import & Export Company Ltd.
Verified Supplier

Anhui

Cheap Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

Cheap Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

Cheap Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs for sale

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Cheap 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor for sale

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Starking Shutter Manufacturer Limited
Verified Supplier

Cheap Polyethylene Foam Sound Insulation Strip For Durable And Effective Noise Reduction for sale

Brand Name:Qiu Zhuo

Model Number:QZ-1285697

Place of Origin:China

Product Description: Self Adhesive Caulking Strip The Self Adhesive Caulking Strip is a revolutionary product made from high-quality Polyethylene Foam. It is designed to provide an easy and effective solution for sound insulation and sealing gaps in your ...

Hebei Jintai Plastic and Rubber Products Co., Ltd.
Verified Supplier

Hebei

Cheap H14 99.995 % Cleanroom HEPA Filter Stainless Steel Separator With CR Seal Strip for sale

Brand Name:LENGE

Model Number:GB820.610-150

Place of Origin:China

...: Galvanized Iron/stainless steel Separator: Aluminum foil/Offset paper Filter Media: Glass fibre Gasket: PU foam seal/CR seal strip Operation Conditions: <80%/100%RH, <80 ℃

Wuxi Lenge Purification Equipments Co., Ltd.
Site Member

Jiangsu

Cheap Electronic Nitrile Rubber Flat Ring Gasket Seal Noise Reduction Product For Weather Insulation for sale

Brand Name:NBR 70 rubber flat ring gasket

Model Number:Customized

Place of Origin:Guangdong,China

Electronic Nitrile Rubber Flat Ring Gasket Seal Noise Reduction Product For Weather Insulation Product Description We offer cylinder head gasket in a variety of elastomers, sizes and shapes and available in custom designed to meet almost any specification...

Dongguan Ruichen Sealing Co., Ltd.
Verified Supplier

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request