| Sign In | Join Free | My insurersguide.com |
|
All foam underlay roll noise reduction wholesalers & foam underlay roll noise reduction manufacturers come from members. We doesn't provide foam underlay roll noise reduction products or service, please contact them directly and verify their companies info carefully.
| Total 128 products from foam underlay roll noise reduction Manufactures & Suppliers |
|
|
|
Brand Name:new top star Model Number:EPE20-4 Place of Origin:china ...Underlay Roll Noise Reduction For Laminated Wooden Flooring 2MM EPE foam with PE FILM Overlapped EPE Underlayment for laminated wooden flooring Product descripition Our 2mm poly cell foam, moister barrier Supreme Underlay is suitable for use with Laminate and Engineered wood floors. This lightweight, dust free underlay... |
Changzhou New Top Star New Material Technology Co.,Ltd
|
|
|
Brand Name:Pholus Place of Origin:Hebei,China Rockwool Insulation Roll 1.2m Width Less Than 0.1mg/L Formaldehyde Emission For Stone Wool *, *::before, *::after {box-sizing: border-box; } * {margin: 0; } html, body {height: 100%; } body {line-height: 1.5; -webkit-font-smoothing: antialiased; } img, ... |
Hebei Fuluosi Building Materials Group Co., Ltd
Hebei |
|
|
Brand Name:No brand Model Number:EVA 30-G Place of Origin:China ... overcome the minor subfloor imperfections and insulate the noise EVA underlay has a variety of applications. They can be used under Engineered wood floor, Luxury Vinyl tile, SPC tile and plank floorings and even laminate floors. Using EVA underlay as a |
Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu |
|
|
Brand Name:LINKWIN Model Number:ZL-CP-7 Place of Origin:China ...foam underlay floor mat carpet roll for inner installation Advantages: 1. We are factory 2. OEM&ODM 3. Environmently friendly 4. OEM&ODM service 5. Luxury underfoot comfort 6. Impact resistant 7. Fire-retardant 8. Antibacterial , for healthful environment 9. Unaffected by moisture 10. Noise reduction... |
ZhenJiang Linkwin International Trading Co., Ltd.
Jiangsu |
|
|
Brand Name:EkkoFlex Place of Origin:Made In China ...Foam Underlayment Attached Pad For Hard Surface Floors The soundproof IXPE foam underlayment with an attached pad is a game-changer for hard surface floors. It significantly reduces impact and airborne noise, making it ideal for multi-story buildings, apartments, and offices. The foam's dense structure absorbs sound vibrations, creating a quieter living and working environment. Besides noise reduction... |
Shenzhen Eco Polyfoam Products Co., Ltd.
Guangdong |
|
|
Brand Name:Rogers Model Number:L-32 Place of Origin:China ...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ... |
SZ PUFENG PACKING MATERIAL LIMITED
Guangdong |
|
|
Brand Name:Skypro Model Number:FU1003 Place of Origin:China ...Foam Underlayment for Laminate Flooring Thermal Insulation Damp-proof EPE Foam Underlayment Specification: EPE Flooring Underlay Specification Density 25kg/m3 (customize available) Roll size 200sq.ft.(1.1m x 16.9m); 100sq.ft.(1.1m x 16.9m); Customizable Thickness 2mm 3mm 4mm 5mm, be made as your requirement Foam... |
Nanjing Skypro Rubber&Plastic Co.,ltd
Jiangsu |
|
|
Brand Name:CYG Model Number:4012 Place of Origin:China 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ... |
Cyg Tefa Co., Ltd.
Guangdong |
|
|
Brand Name:Xinmei Model Number:TDP-S-4 Place of Origin:Qingdao, China ...Foam Sponge Low Noise Knife Crushing Machine Blade Shredder Crusher Product Description: This machine is mainly used for crushing sponge, cloth sponge, PEA, EVA, plastic and rubber, and can be used in conjunction with foam recycling equipment. It is equipped with a noise reduction and damping device. The advantages include high crushing efficiency, low noise... |
Qingdao Xinmeiteng Sponge Manufacture Co.
Shandong |
|
|
Brand Name:JOYWAY Model Number:Tile-06 Place of Origin:SHANDONG, CHINA ... beautiful , and durable , can enhance the dust removing effect. Cleaning is simple and convenient, a salt water, brush can care. Rubber EPDM roll offers excellent underfoot comfort, absorbs walking noise and the shock of training impact. Being made of |
JOYWAY INDUSTRIAL COMPANY LIMITED
Shandong |
|
|
Brand Name:HaiKe Model Number:HK95020 Place of Origin:Chongqing China Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ... |
Chongqing Haike Thermal Insulation Material Co., Ltd.
Chongqing |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Categories:Aluminum Roller Shutter Door Country/Region:china Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam... |
Starking Shutter Manufacturer Limited
|
|
|
Brand Name:JYD Model Number:custom made Place of Origin:China ... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through... |
Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan |
|
|
Brand Name:Flooring Source Model Number:FS-R100 Place of Origin:China ...Roll Garage Warehouse Industrial Work Non Slip Noise Reduction Non-slip rubber matting roll designed for garage, warehouse and industrial work use is a heavy-duty flooring solution tailored to withstand high-traffic environments while providing traction, durability and comfort. ◆ The matting roll... |
Aomi International (Beijing) Co., Ltd
Beijing |
|
|
Brand Name:Future Tech Model Number:FT-EM5002 Place of Origin:Shenzhen China ...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam... |
FUTURE TECH LIMITED
|
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job ... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |