31db nrr foam ear plugs

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs...

Brand Name:Futuretech

Model Number:FTFE-04

Place of Origin:Shenzhen

... For Snoring, Shooting, Yard Work, Concerts, And All Other Loud Activities. Brand new and high quality. Length: Approx. 25 inches. NRR 25dB. WASHABLE AND REUSABLE Our reusable silicone ear plugs are designed to last for a long period of time for

Place of Origin:yangzhou

Brand Name:Xinfly

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ...

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Place of Origin:China

Brand Name:DISHINE

Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing...

Brand Name:BSL

Model Number:SLE-EC-2001C

Place of Origin:CHINA

Material: reusable silicone CE ANSI AS/NZS 1270 Quality: good quality CE: SNR: 28db ANSI: NRR: 25db rope: w/o rope, with cotton rope with PVC rope Color: yellow, orange, red, blue, green Packing: plastic bag or box 2000pcs/ctn 66x42x42mm 480000 pcs/20’

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

Description 100% PVC-Free, slow rebound, various rebound time are welcomed Our foam earplugs are made of extra-soft, lightweight foam that seals the ear canal without pressure, tensile, disposable Bullet shape for a snug fit while gently conforming to the ...

Brand Name:D-Jeesian

Model Number:H09-FEM19009

Place of Origin:GuangDong/China

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ...

Place of Origin:Guangdong, China

Model Number:XT-EY008

Hot Selling Comfortable Luxury Fashion Memory Foam Sleeping Covers 3D lint free eye patch with Ear Plugs Product Description eye mask Item: sleeping eye mask Material: 3D memory foam Size: 23*8.5cm or customized Color: Customized any color MOQ: 3000pcs ...

Brand Name:SAFEYEAR

Model Number:E-1013

Place of Origin:CHINA

E-1013 Bullet Type Earplug For Good Sleeping Soft Resilient Material * Use: Improve sleep, concentrate on the spirit, protect hearing, etc. * Place: Can be used in homes, dormitories, classrooms, construction sites, factories and other places. * Efficacy: ...

Place of Origin:Zhejiang, China

Brand Name:WELWORK

Model Number:EM108

... filter Earmuff NRR 31dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per polybag,50pcs per carton Terms of Payment T/T Port of

Brand Name:Amydi-med or Customized

Model Number:AMD-DP-EC0007-X

Place of Origin:China

...Ear Canal Foam Skin Temperature Probe Skin Temperature Probe Quick Details: Product Name: Skin Temperature Probe Model no.: AMD-DP-EC0007-X Compatible brand : VR medical (thin)2.25K Plug: VR 2Pin Cable color: White cable Cable material: PVC, Probe material: Foam...

Brand Name:DL

Model Number:DL-G19

Place of Origin:CHINA

...Ear Headphone With Mic-Mute For PC Features: ♫【Humanized Design& Comfortable for Wearing】Easy to control the button of Mute and the flexible mic of the headset at any time without disturbing your gaming. Superior comfortable memory foam and good air permeability over-ear adjustable pads can reduce hearing impairment and heat sweat for long time wearing ♫【Fancy Led Light】Plug...

Brand Name:picun

Model Number:ANC-02

Place of Origin:Made in China

... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,