Sign In | Join Free | My insurersguide.com
insurersguide.com
Products
Search by Category
Home > Chemicals > Pharmaceuticals > Animal Pharmaceuticals >

Growth Hormone Disorder

1-10 Results for

growth hormone disorder

from 1468 Products

Increase HGH Human Growth Hormone Stimulators / Hgh Hormones Muscle Growth

China Increase HGH Human Growth Hormone Stimulators / Hgh Hormones Muscle Growth on sale
... GHRP-6 (Growth Hormone Releasing Peptide-6) is a Hexa-peptide which promotes food intake by stimulating hunger and helps increase energy metabolism. It is most commonly used for treatment of Growth Hormone (GH) deficiencies, eating disorders, obesity......
Wuhan Disel Biotechnology Co., Ltd.

Address: No.6 Fozuling 3th Road, East Lake High-tech Development Zone, Wuhan City, Hubei Province, China 430000

CAS 96827-07-5 Human Growth Hormone Gensci Jintropin HGH 100iu/Box For Anti Aging

China CAS 96827-07-5 Human Growth Hormone Gensci Jintropin HGH 100iu/Box For Anti Aging on sale
...Human growth hormone Gensci Jintropin Hgh 100iu/box injections Quick details: Product name:jintropin hgh Other names:jintropin ......
HONGKONG RONGXIN BIO-TECH CO.,LTD

Address: Xi'an Jianshe Mansion,China, Shaanxi Sheng, Xian Shi, Yanta Qu, QuJiang ShangQuan, Yanta S Rd

Fat Loss Peptide GHRP-6 Human Growth Hormone Peptide 5mg 10mg / Vial Weight Loss Lab Supply

China Fat Loss Peptide GHRP-6 Human Growth Hormone Peptide 5mg 10mg / Vial Weight Loss Lab Supply on sale
... building Quick detail: GHRP-6 (5mg/vial;10mg/vial) GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 CAS: 158861-67-7 M.F.: C42H50N8O5 M.W.: 746.90 M.S.: Purity (HPLC): 98.0%min. Appearance: White powder......
Yihan Industrial Co.,Ltd.

Address: Room 301-7A,3/F,HongKong Trade Centre,161-167 DES VOEUX ROAD,CENTRAL,HK

Human Growth Hormone Peptide Gonadorelin 2mg Injection CAS71447-49-9

China Human Growth Hormone Peptide Gonadorelin 2mg Injection CAS71447-49-9 on sale
...Human Growth Hormone Peptide Gonadorelin 2mg Injection CAS71447-49-9 Quick detail: Product Name: Gonadorelin Molecular formula: C55H75N17O13.2(C2H4O2) ......
Yihan Industrial Co.,Ltd.

Address: 1st Building,JingNan Industrial Zone,JingNan Road,BuJi Town,LongGang District,ShenZhen,China,518000

Pharma Grade PT 141 Peptide Growth Hormone Bremelanotide 10mg For Treat Sexual Disorders

China Pharma Grade PT 141 Peptide Growth Hormone Bremelanotide 10mg For Treat Sexual Disorders on sale
...PT141 Human Growth Peptides Powder PT-141 for Treating Sexual Disorders PT141 Bremelanotide Details: PT-141 Name: PT-141 PT-141 Cas No. :32780-32-8 PT-......
Hongxi International Pharmaceutical Co., Ltd.

Address: 2/F, Universal Building, 5-13 New St, Tai Ping Shan, Hongkong

140703-51-1 Anti Aging Growth Hormone Peptides Hexarelin 2mg / Vials for Fat Burning

China 140703-51-1 Anti Aging Growth Hormone Peptides Hexarelin 2mg / Vials for Fat Burning on sale
...Anti Aging Growth Hormone Peptides Hexarelin 2mg/Vials for Fat Burning Basic Information: Single Impurity (HPLC): 0.5%max Amino Acid ......
Wuhan Body Biological Co.,Ltd

Address: Room 4331, 3th building, high-tech industrial park, yizhi road, qingshan district, wuhan, China

Muscle Building Human Growth Hormone Steroids GHRP-6 Peptide CAS 87616-84-0

China Muscle Building Human Growth Hormone Steroids GHRP-6 Peptide CAS 87616-84-0 on sale
... by stimulating hunger and helps increase energy metabolism. Growth Hormone Releasing Peptide, similar to GHRP-6, are most commonly used for treatment of Growth Hormone (GH) deficiencies, eating disorders, obesity, etc. Research has shown that use......
Hongkong Kangdisen Medical Co., Limited

Address: ROOM C1D, 6/F, WING HING INDUSTRIAL BUILDING, 14 HING YIP STREET, KWUN TONG, KOWLOON, HONG KONG

CAS 87616-84-0 Pharmaceutical Grade Growth hormone releasing peptide GHRP-6

China CAS 87616-84-0 Pharmaceutical Grade Growth hormone releasing peptide GHRP-6 on sale
...Hot Sale Growth hormone releasing peptide GHRP-6 CAS 87616-84-0 Product Name GHRP-6 (Growth hormone releasing peptide) CAS 87616-84-0 Molecular Formula C46H56N12O6 Molecular Weight 873.01 Purity (HPLC) 98.0%......
Hangzhou Fuluo Biological Technology Co.,Ltd.

Address: 288# Xinfeng Road,Jianggan District,Hangzhou,Zhejiang,China

High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation

China High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation on sale
...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ......
Jiangsu Biostronger Technology Co.,Ltd

Address: Hehai Road, Xinbei disctrict, Changzhou, Jiangsu, China

GH 191 AA Pure Grade Male Human Growth Hormone For Professional Bodybuilders Atheletes Gain Muscle

China GH 191 AA Pure Grade Male Human Growth Hormone For Professional Bodybuilders Atheletes Gain Muscle on sale
...GH 191 AA(Human Growth Hormone ) Golden Quality 10iu/vial for Build muscle Product Name: F-Bio Pharma GH 191 AA Specification:......
Passion Technology Development Limited

Address: Shangshuyuan South of Nongye Rd.,Zhengdong New District, Zhengzhou, Henan, China 450000

Submit your growth hormone disorder inquiry in a minute :
*From:
Your email address is incorrect!
To:

Passion Technology Development Limited

Products: GH 191 AA Pure Grade Male Human Growth Hormone For Professional Bodybuilders Atheletes Gain Muscle

*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
 
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want everychina.com to recommend me more suppliers.
Submit growth hormone disorder inquiry
*From:
Your email address is incorrect!
*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!
Inquiry Cart 0