Sign In | Join Free | My
Search by Category
Home > Health & Medical > Health Product Agents >

Derma Roller Hair Growth

derma roller hair growth

All derma roller hair growth wholesalers & derma roller hair growth manufacturers come from members. We doesn't provide derma roller hair growth products or service, please contact them directly and verify their companies info carefully.

Total 1262 products from derma roller hair growth Manufactures & Suppliers
Cheap 192 Pins DNS Derma Roller Hair Growth Devices Anti - Inflammation for sale

Brand Name:DNS Derma Roller

Model Number:192

Place of Origin:Guangzhoou, China

...China Wholesale 192 Pins DNS Derma Roller Titanium Derma Roller for Hair loss Treatment DNS192 Work theory Dermaroller uses a knead rod inlayed with numbers of needles,combining ...

Guangzhou Ekai Electronic Technology Co.,Ltd.
Verified Supplier


Cheap Skin Maintenance Face Needle Roller , Lightweight Hair Derma Roller Hair Growth for sale

Brand Name:SQY

Model Number:GT-R005

Place of Origin:Guangzhou

...Microneedle Derma Roller / 540 Derma Roller With Different Color The Description of Microneedle Derma Roller 1. The needle roller is 540 Derma Roller 2. Does not destroy the structural integrity of the skin 3. Gradually remove the skin deep toxins ...

Guangzhou Zusing Electronic Technology Co., Ltd.
Verified Supplier


Cheap Newest High Quality Anti Wrinkle Micro Needle Derma Roller For Skin Care for sale

Brand Name:MT

Model Number:CTM028RL

Place of Origin:Guangzhou China

...Newest High Quality Anti Wrinkle Micro Needle Derma Roller For Skin Care Product Specifications : Type : 540 derma roller Function: encourage nutrient absorption Handle material: 100% environmental medical PC Needle material: titanium alloy/imported ...

Guangzhou Wenshen Cosmetics Co., Ltd.
Verified Supplier


Cheap 540 Purple Roller Black Handle Microneedle Derma Roller Home Care Dodge Wrinkles for sale

Brand Name:Lushcolor

Model Number:CTM032RL

Place of Origin:China

...540 Purple Roller Black Handle Microneedle Derma Roller Home Care Dodge Wrinkles Specifications : Name DRS540 Microneedle Derma Roller Item No. CTM032RL Color Purple Needle Length 0.2mm, 0.25mm, 0.3mm, 0.5mm, 1.0mm, 1.5mm, 1.75mm, 2.0mm, 2....

Guangzhou Baiyun Jingtai Qiaoli Business Firm
Verified Supplier


Cheap Skin Care Microneedle Derma Roller 200 Needles , Stretch Mark Removal Derma Roller for sale

Brand Name:iTech Aesthetics

Model Number:DRS200

Place of Origin:China

...OEM Skin Care Dermarolling , 200 Needles Derma Rollers Skin Roller , Hair Roller , Body Roller TREATMENT THEORY 200 derma rollers therapy uses a knead rod inlayed with numbers of needles , combining with functional nutrition liquid , regularly ...

iTech Aesthetics Limited
Verified Supplier


Cheap 180 DRS Micro Needle Derma Roller 0.5 mm For Eyes And Eyeliner MTS for sale

Brand Name:DRS Derma Roller

Model Number:DRS180

Place of Origin:China

...180 DRS Micro Needle Derma Roller 0.5 mm For Eyes And Eyeliner MTS Parameter Product name Derma roller 180 Feature 180 tiny pins on the roller Color Black/white Needle including 180 Needle length 0.5mm Function...

OH Tattoo Equipment Co., Ld
Verified Supplier


Cheap Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide for sale

Brand Name:SMQ

Model Number:86168-78-7

Place of Origin:china

...Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide Quick Detail: Product Name:Sermorelin Synonyms:SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier


Cheap 32 * 60mm yellow plastic hair roller , hair curler roll for girl  / female for sale

Brand Name:SZD

Model Number:HR007

Place of Origin:China

...32 * 60mm yellow plastic hair roller , hair curler roll for girl / female After use Our Service Any size and pattern are available ...

Shenzhen Zhongda Hook & Loop Co., Ltd
Verified Supplier


Cheap 6 in 1 derma roller set 12/300/720/1200 needles titanium micro needle therapy dermaroller for sale

Brand Name:FionaLaser

Model Number:FL-R61

Place of Origin:Beijing, China

... What is a Derma roller and what does it do? Skin needling is a procedure that involves puncturing the skin multiple times with small needles attached to a cylindrical roller (Derma roller) to induce collagen growth and improve atrophic...

Fiona Laser Technology Development Co.,ltd
Verified Supplier


Cheap Duagen Avodart Hair Growth Drug Dutasteride Androgenic Alopecia Treatment Steroid Hormone for sale

Brand Name:HKYC

Model Number:164656-23-9

Place of Origin:China (mainland)

...Quick Detail: Avodart Pharmaceutical Raw Materials Hair Growth Drug Dutasteride for the Treatment of Androgenic Alopecia 2. Description: English name: Dutasteride CAS: 164656-23-9 ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Cheap Small Titanium ZGTS Derma Roller hair growth 2.0 mm , 2.5 mm , 3.0 mm with ABS handle for sale

Place of Origin:china

Brand Name:ZGTS

Model Number:ZGTS-02

...Small Titanium ZGTS Derma Roller hair growth 2.0 mm , 2.5 mm ,3.0 mm with ABS handle specification: - Needles: 540 needles - Handle color : black / white - Needle ...

Kimlida Electronic Technology Co., Ltd
Active Member


Cheap Genuine Microneedle Skin Roller / Derma Roller Hair Loss Anti Aging At Home for sale

Brand Name:wonder

Model Number:Dermaroller

Place of Origin:China

...Genuine Microneedle Skin Roller / Derma Roller Hair Loss Anti Aging At Home Description: This kind of roller is intended to stimulate the skin and improve the adsorption rate of the active ingredients....

JiNing Wonder Trading Co.,LTD
Active Member


Cheap Stimulate Collagen Growth Needle Derma Roller , Cellulite Reduction Gm1080 for sale

Place of Origin:China

Brand Name:GTO

Model Number:GM1080

...Stimulate Collagen Growth Needle Derma Roller , Cellulite Reduction Gm1080 Model Number: GM1080 Description: 1080 needles derma roller Stainless Steel needles and Titanium Alloy needles Micro needle derma system What Are Dermarollers Dermarolling is also ...

GTO Science & Technology Co., Ltd
Active Member


Cheap White / Auburn Instant Hair Building Fiber Natural Hair Growth Products For Women for sale

Brand Name:Hair Me

Model Number:HM-1002

Place of Origin:China

... micro fiber, or hair fiber powders. They thicken hair very quickly, people like them as instant hair fibers, or instant hair growth. Instant Hair Building Fiber is tiny fiber is a breakthrough product for hair loss sufferers and...

Guangzhou Guwei Biology Technology Co,.ltd
Site Member


Cheap 3 in 1 function Vibration LED Microneedle derma rollers for sale

Place of Origin:China

Brand Name:SCAPE

... LED Microneedle derma rollers Parameter -9disks x 60needles (540 needles in total) -Needle material : Medical stainless steel / Fine titanium -Handle/Roller Material : PC+ABS -High sealing sterilization packaging -Roller: replacement roller head -LED...

Guangzhou SCAPE Electronic Sci-Tech Co. Ltd
Active Member


Cheap Portable LED Needle Derma Roller , Can Change Head 540 Needles Photon Dermaroller for sale

Place of Origin:China

Brand Name:GTO

Model Number:GM-2.0A

...Portable LED Needle Derma Roller , Can Change Head 540 Needles Photon Dermaroller Model Number: GM-2.0A Specifications: Needle material: titanium ...

GTO Science & Technology Co., Ltd
Site Member


Cheap 2017 Hydra Needle 20 pins Micro Needle/ Skin Care Painless Derma Stamp with Screw thread/Derma roller for sale

Brand Name:iTech Aesthetics

Model Number:HY20

Place of Origin:China

... Needle 20 pins Micro Needle/ Skin Care Painless Derma Stamp with Screw thread Hydra needle is micro needle device for delivering cosmeceutical and hair growth solution into the dermis by lightly tapping it...

---- Guangzhou iTech Aesthetics Limited ----
Active Member


Cheap Nylon hook & loop tape Soft Heated magic Rollers / Hair Sheets Custom Shape for sale

Brand Name:OEM

Model Number:TSDHR-060

Place of Origin:Shenzhen , China

... magic Rollers / Hair Sheets Custom Shape 1 . Specifications : Item Hair hooks Material Nylon / polyester Shape Tapes or customized shape Colour Colourful Feature Soft and safty Service Precut to any shape as request Application Hair Accessory...

Shenzhen Tesida Textile Goods Co., Ltd.
Site Member


Cheap Elight shr ipl for derma seta hair removal for sale

Place of Origin:Beijing, China

Brand Name:NUBWAY

Model Number:NBW-SHR212

...Elight shr ipl for derma seta hair removal Introduction SHR is short for Super Hair Removal, a technology for permanent hair removal. This system combines laser technology and the benefits of the pulsating light method...

Beijing Nubway S&T Co., Ltd
Site Member


Cheap Original Herbal Sunburst Hair Growth Liquid For Hair Loss for sale

Place of Origin:China

Brand Name:sunburst

Model Number:6088

...Original Herbal Sunburst Hair Growth Liquid For Hair Loss Description Original real result sunburst hair growth 6in1 shou bang Additional Hair Dense hair liquid Item Type: Hair Loss Product Brand Name: Sunburst Ingredient: Herbal Model Number: 6088 Size...

Active Member


Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request