Sign In | Join Free | My insurersguide.com
insurersguide.com
Products
Search by Category
Home > Chemicals > Chemical Projects >

Augment Anabolic Hormone Side Effects

augment anabolic hormone side effects

All augment anabolic hormone side effects wholesalers & augment anabolic hormone side effects manufacturers come from members. We doesn't provide augment anabolic hormone side effects products or service, please contact them directly and verify their companies info carefully.

Total 150 products from augment anabolic hormone side effects Manufactures & Suppliers
Cheap Test Enanthate Powder Legal Injectable Steroids Hormone CAS 315 37 7 For Muscle Gaining for sale

Brand Name:LSW

Model Number:315-37-7

Place of Origin:China

...Injectable Anabolic Steroids Test Enanthate Steroids Hormone for Muscle Gaining CAS:315-37-7 Description: Testosterone Enanthate is one of the oldest and perhaps the most commonly used anabolic steroid of all time. Testosterone...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Cheap Healthy Muscle Building Anabolic Steroids , High Pure Muscle Enhancing Steroids for sale

Brand Name:Pharmlab

Model Number:Anabolic Steroids

Place of Origin:China

...An Detailed Article About How Some Anabolic Steroid Use and Abuse Overview Steroids are a general class of agents that all have the ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Cheap Drostanolone Propionate Masteron 150 mg/ml anabolic steroids injection oil liquid for sale

Brand Name:Hongkong Saichuang

Model Number:Injectable anabolic steroids

Place of Origin:China

...Drostanolone Propionate Masteron 150 mg/ml anabolic steroids injection oil liquid for muslce bodybuilding 1. Quick Detail: Injectable Anabolic Steroids Cutting Cycle Steroids Masteron Propionate Drostanolone Propionate 150mg/ml Masteron 150 2. Description:...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Cheap 99% Purity Hgh Human Growth Hormone Muscle Building Somatropin IGTROPIN / IGF-1 Lr3 for sale

Brand Name:Human Growth Hormone

Model Number:IGTROPIN / IGF-1 Lr3

Place of Origin:China

...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

Global chemicals Co.,Ltd
Verified Supplier

Cheap Injectable HGH Hormones Igtropin IGF-1 Long-R3 For Body Building and Weight Loss for sale

Place of Origin:China(Mainland)

Brand Name:SUPER STEROIDS

Model Number:mandy@chembj.com

99.4% Injectable HGH Igtropin IGF-1 Long-R3 For Body Building & Fat Loss Quick Details: Igtropin Alias : Long-R3 , IGF-1 MF : C20H28O2 MW : 300.44 Purity : 99.4% Appearance : White Powder Grade : Pharmaceutical Grade Storage: Closed, below 2 ~ 8℃ ...

Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
Verified Supplier

Hubei

Cheap Injectable Testosterone Injections Steroids Testosterone Propionate 100mg/ml For Muscle Mass for sale

Brand Name:TINGYI

Model Number:Testosterone Propionate 100mg/ml

Place of Origin:China

... Propionate 100mg/ml Application: injectable Class:Anabolic/Androgenic Steroid Effective Dose (Men): 350-2000mg+ week. Effective Dose (Women): 50-100mgs/week Active life: 2-3 days Detection Time: 2-3 weeks Anabolic/Androgenic ratio:100/100. stacks

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Cheap High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation for sale

Brand Name:SGH

Model Number:12629-01-5

Place of Origin:China

...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Cheap White Powder Hgh Human Growth Hormone Igtropin IGF-1 HGh Fragment Cas 12629-01-5 for sale

Brand Name:Igtropin

Model Number:Igtropin

Place of Origin:china

...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

Shandong Chuangrui Chemical Technology Co., Ltd.
Verified Supplier

Shandong

Cheap Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin for sale

Brand Name:HKYC

Model Number:196078-30-5

Place of Origin:China

...Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin Basic Info. Name: Pramlintide Acetate Cas No.: 196078-30-5 ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Cheap Dbol Injectable Anabolic Dianabol 50mg / ml For Bodybuilding Steroids for sale

Brand Name:Hong Kong Blue Universal

Model Number:CAS:72-63-9

Place of Origin:China

...Dbol Injectable Anabolic Dianabol 50mg / ml For Bodybuilding Steroids Dianabol 50 Cook Recipe: (Notes: BB=benzyl benzoate; BA=...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Cheap Igtropin IGF-1 Lr3 Oral Human Growth Hormone With Amino Acid Absorption for sale

Brand Name:SR

Model Number:94-24-6

Place of Origin:China

.../vial,10vials/kit,1mg/vial,10vials/kit Purity 99.9% Product Description: 1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF...

Shandong Shengri Chemical Co., Ltd.
Verified Supplier

Shandong

Cheap 99% Human Growth Hormone Muscle Building Human Somatropin IGTROPIN / IGF-1 Lr3 for sale

Brand Name:Mking

Model Number:IGTROPIN

Place of Origin:Hubei, China

...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

Hubei Mking Biotech Co., Ltd.
Verified Supplier

Hubei

Cheap Depot Vial Finished Injectable Oil Liquid Anabolic Steroids Winstrol 50mg / Ml Muscle Growth for sale

Brand Name:YIHAN

Model Number:YH-Tren-100

Place of Origin:China

...Depot Vial Finished Injectable Oil Liquid Anabolic Steroids Winstrol 50mg / Ml Muscle Growth Quick Details: Name Winstrol 50ml Other name Stano Zolol, ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Cheap Igf-1lr3 Peptides Steroids Customzied Igf-1 LR3 1mg Growth Hormone Peptide For Injection for sale

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

Follistatin 344 Peptides Steroids Follistatin-315 Fat Burning Peptide For Bodybuildier​ Product information: Product name:IGF-1Lr3 IGF-1Lr3 CAS No.:946870-92-4 IGF-1Lr3 Purity:.98%min IGF-1Lr3 Appearance:White powder IGF-1Lr3 Storage:Dry Cool Place IGF-...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Cheap Aicar CAS 2627-69-2 Anabolic Steroids Muscle Growth Sarms For Bodybuilding for sale

Brand Name:YUANHANG

Model Number:2627-69-2

Place of Origin:CHINA

Sarms Powder Aicar CAS 2627-69-2 for Muscle Growth with Disguised package Abstract ProName: Factory supply SARMS AICAR(Acadesine) ... CasNo: 2627-69-2 Molecular Formula: C9H14N4O5 Appearance: powder Application: BodyBuilding DeliveryTime: in stock PackAge...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Cheap Weight Loss HGH Human Growth Hormone Injections IGF 1 Long R3 CAS  946870-92-4 for sale

Brand Name:Rund

Model Number:CAS 946870-92-4

Place of Origin:China

...Body Building and Weight Loss Injectable HGH Hormones Igtropin IGF-1 Long-R3/Long R3-IGF-1 CAS 946870-92-4 Details Product name:IGF-1 Long-...

3M Biotech Co., Ltd
Verified Supplier

Cheap Pure Raw Hormone Powders Testosterone Propionate 100 For Muscle Enhancement for sale

Brand Name:Yuancheng

Model Number:57-85-2

Place of Origin:China

...: 1. It can be used in the clinical treatment of male sexual dysfunction 2. It has a significant effect on the disease of aplastic anemia 3. It can be used by veterinarians on livestock to...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Cheap 55-06-1 Fat Loss Steroids For Losing Weight Liothyronine Sodium T3 L-Triiodothyronine Hormone for sale

Brand Name:Grand Uni or OEM

Model Number:CAS:55-06-1

Place of Origin:China

...55-06-1 Fat Loss Steroids For Losing Weight Liothyronine Sodium T3 L-Triiodothyronine Hormone Quick Detail: 1 ) CAS NO : 55-06-1 2 ) EINECS : 200-223-5 3 ) Chemical name : 3,3',5-Triiodo-L-thyronine, sodium salt 4 ) ...

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

Cheap Injectable HGH Hormones Igtropin IGF-1 Long-R3 For Body Building and Weight Loss for sale

Brand Name:YIJING

Model Number:HGH

Place of Origin:SHANGHAI

...Injectable HGH Hormones Igtropin IGF-1 Long-R3 For Body Building and Weight Loss Quick Details: Igtropin Alias : Long-...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Cheap Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 for sale

Brand Name:GB

Place of Origin:China

...Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 Product name Igtropin Alias Long-R3 , IGF-1 Appearance White Freeze-...

Hubei God bull Pharmaceutical Co.,Ltd
Site Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request